Product Information
12819-1-AP targets EMP3 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3449 Product name: Recombinant human EMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-139 aa of BC009718 Sequence: KSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCF Predict reactive species |
Full Name | epithelial membrane protein 3 |
Calculated Molecular Weight | 163 aa, 18 kDa |
GenBank Accession Number | BC009718 |
Gene Symbol | EMP3 |
Gene ID (NCBI) | 2014 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P54852 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |