Product Information
27683-1-AP targets EN1 in ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26688 Product name: Recombinant human EN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-197 aa of NM_001426 Sequence: MNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGN Predict reactive species |
| Full Name | engrailed homeobox 1 |
| Calculated Molecular Weight | 40 kDa |
| GenBank Accession Number | NM_001426 |
| Gene Symbol | EN1 |
| Gene ID (NCBI) | 2019 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05925 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
