Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26082-1-AP targets ENT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23310 Product name: Recombinant human SLC29A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 214-321 aa of BC093634 Sequence: PHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSP Predict reactive species |
| Full Name | solute carrier family 29 (nucleoside transporters), member 2 |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC093634 |
| Gene Symbol | SLC29A2 |
| Gene ID (NCBI) | 3177 |
| RRID | AB_3669522 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14542 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC29A2 also known as ENT2, comprises 456 amino acids and shares 46% amino acid identity with ENT1. ENT2 is involved in the facilitative transport of nucleosides and nucleobases and maintains their cellular homeostasis. The predicted molecular weight of ENT2 is 50 kDa, while 45 kDa band may be observed due to the deglycosylation (PMID: 10722669)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ENT2 antibody 26082-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

