ENTPD5 Polyclonal antibody

• 

  WB analysis of mouse liver using 26746-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26746-1-AP (ENTPD5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 26746-1-AP

  IP result of anti-ENTPD5 (IP:26746-1-AP, 4ug; Detection:26746-1-AP 1:300) with mouse liver tissue lysate 6000ug.

• 

  IHC staining of human liver using 26746-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26746-1-AP (ENTPD5 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 26746-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26746-1-AP (ENTPD5 Antibody) at dilution of 1:200 (under 40x lens).

ENTPD5 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 26746-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

CD39 antigen-like 4, CD39L4, EC:3.6.1.6, ER UDPase, ER-UDPase

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26746-1-AP targets ENTPD5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25022

  Product name: Recombinant human ENTPD5 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 335-428 aa of BC130485

  Sequence: RAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

• Full Name: ectonucleoside triphosphate diphosphohydrolase 5
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC130485
• Gene Symbol: ENTPD5
• Gene ID (NCBI): 957
• RRID: AB_2880619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75356
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ectonucleoside triphosphate diphosphohydrolases (NTPDases) are enzymes that are involved in the degradation of di- and triphosphate nucleotides, with important implications in several biological processes that underlie a number of physiological and pathological conditions, including cancer [PMID: 34272651]. ENTPD5 gene, hydrolyzes UDP to UMP and is mainly localized inside the cell, where it plays a critical role in the N-glycosylation and proper folding of proteins in the endoplasmic reticulum [PMID: 21074248]. It can also be secreted into the extracellular space and can work as a soluble enzyme upon cleavage of a signal peptide [PMID: 15698960]. NTPDase5 is often deregulated in cancer, likely as a consequence of TP53 mutations, where it promotes and favours tumour progression and metastasis [PMID: 27956623]. Furthermore, short NPTDase5 peptides were detected in normal and tumour cell lines, recalling the mt-PCPH oncoprotein, a truncated form of the enzyme originating from a single-nucleotide deletion described in Syrian hamster and lacking enzymatic activity [PMID: 27956623].