ENTPD5 Polyclonal antibody

ENTPD5 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 26746-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

CD39 antigen-like 4, CD39L4, EC:3.6.1.6, ER UDPase, ER-UDPase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26746-1-AP targets ENTPD5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25022

Product name: Recombinant human ENTPD5 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 335-428 aa of BC130485

Sequence: RAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

Predict reactive species
Full Name ectonucleoside triphosphate diphosphohydrolase 5
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC130485
Gene Symbol ENTPD5
Gene ID (NCBI) 957
RRIDAB_2880619
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75356
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ectonucleoside triphosphate diphosphohydrolases (NTPDases) are enzymes that are involved in the degradation of di- and triphosphate nucleotides, with important implications in several biological processes that underlie a number of physiological and pathological conditions, including cancer [PMID: 34272651]. ENTPD5 gene, hydrolyzes UDP to UMP and is mainly localized inside the cell, where it plays a critical role in the N-glycosylation and proper folding of proteins in the endoplasmic reticulum [PMID: 21074248]. It can also be secreted into the extracellular space and can work as a soluble enzyme upon cleavage of a signal peptide [PMID: 15698960]. NTPDase5 is often deregulated in cancer, likely as a consequence of TP53 mutations, where it promotes and favours tumour progression and metastasis [PMID: 27956623]. Furthermore, short NPTDase5 peptides were detected in normal and tumour cell lines, recalling the mt-PCPH oncoprotein, a truncated form of the enzyme originating from a single-nucleotide deletion described in Syrian hamster and lacking enzymatic activity [PMID: 27956623].

Protocols

Product Specific Protocols
IHC protocol for ENTPD5 antibody 26746-1-APDownload protocol
IP protocol for ENTPD5 antibody 26746-1-APDownload protocol
WB protocol for ENTPD5 antibody 26746-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...