Tested Applications
Positive WB detected in | PC-3 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IP | See 1 publications below |
Product Information
15778-1-AP targets ENY2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8462 Product name: Recombinant human ENY2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC007870 Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL Predict reactive species |
Full Name | enhancer of yellow 2 homolog (Drosophila) |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC007870 |
Gene Symbol | ENY2 |
Gene ID (NCBI) | 56943 |
RRID | AB_2878184 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NPA8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ENY2, also named as DC6, is involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. It is required for nuclear receptor-mediated transactivation. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). The MW of ENY2 is about 10 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ENY2 antibody 15778-1-AP | Download protocol |
IHC protocol for ENY2 antibody 15778-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |