EPB41L4A Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 26596-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26596-1-AP (EPB41L4A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 26596-1-AP

  WB result of EPB41L4A antibody (26596-1-AP; 1:300; room temperature for 1.5 hours) with negatove control and EPB41L4A overexpressed Transfected HEK-293 cells.

EPB41L4A Polyclonal Antibody for WB, ELISA

Cat No. 26596-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Band 4.1 like protein 4A, EPB41L4, EPB41L4A, NBL4, Protein NBL4

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, Transfected HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26596-1-AP targets EPB41L4A in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23923

  Product name: Recombinant human EPB41L4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-106 aa of BC031042

  Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKL

• Full Name: erythrocyte membrane protein band 4.1 like 4A
• Observed Molecular Weight: 36 kDa, 79 kDa
• GenBank Accession Number: BC031042
• Gene Symbol: EPB41L4A
• Gene ID (NCBI): 64097
• RRID: AB_2880569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCS5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.