EPHA2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EPHA2 Monoclonal antibody (66736-1-Ig)

• Featured Product
• KD/KO Validated

EPHA2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66736-1-Ig Copied!

Clone No. 1A9C3

Publications (14)

Reviews (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1A9C3, EC:2.7.10.1, ECK, EPH receptor A2, Ephrin type A receptor 2

• 

  WB analysis using 66736-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66736-1-Ig (EPHA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 66736-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EPHA2 antibody (66736-1-Ig, Clone: 1A9C3 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EPHA2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HEK-293 cells, BxPC-3 cells, MCF-7 cells, HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66736-1-Ig targets EPHA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22566

  Product name: Recombinant human EPHA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 271-535 aa of BC037166

  Sequence: DACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNL

• Full Name: EPH receptor A2
• Calculated Molecular Weight: 976 aa, 108 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC037166
• Gene Symbol: EPHA2
• Gene ID (NCBI): 1969
• RRID: AB_2882086
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P29317
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPHA2 (Ephrin type-A receptor 2) belongs to the receptor tyrosine kinase (RTK) family, with 16 known receptors and 9 known membrane-bound ligands in all species. Based on the extracellular domain sequence homology, structure, and binding affinity, Eph receptors and their ephrin ligands can be divided into A and B subtypes (PMID: 33962882). EPHA2 contains a conserved N-terminal ligand-bound extracellular domain, a transmembrane domain, and a conserved tyrosine kinase domain (PMID: 8070404).

Publications

What published studies show

The anti-EphA2 antibody (Cat# 66736-1-Ig) has 14 citations published in journals including Cell Mol Life Sci, Apoptosis, Mol Ther Nucleic Acids, Int J Mol Sci, Chem Biol Interact, J Oncol, Antiviral Res, Exp Cell Res, Arch Biochem Biophys, J Alzheimers Dis, Biochem Biophys Res Commun, and Neoplasma. Research fields span hepatocellular carcinoma, triple-negative breast cancer, cervical cancer, glioma, gastric cancer, Alzheimer's disease, SARS-CoV-2 antiviral therapy, ferroptosis, EMT, and autophagy.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Apoptosis; EFNA4-enhanced deubiquitination of SLC7A11 inhibits ferroptosis in hepatocellular carcinoma; Authors - Xingyi Zhong
human	WB	Mol Ther Nucleic Acids; EFNA4 promotes cell proliferation and tumor metastasis in hepatocellular carcinoma through a PIK3R2/GSK3β/β-catenin positive feedback loop.; Authors - Junhao Lin
human	WB,IHC	Cell Mol Life Sci; EphA2 promotes the transcription of KLF4 to facilitate stemness in oral squamous cell carcinoma; Authors - Junqiang Bai
human	WB	Int J Mol Sci; Role of Nuclear Claudin-4 in Renal Cell Carcinoma.; Authors - Takuya Owari
human	WB	Chem Biol Interact; 2-Methoxy-5((3,4,5-trimethosyphenyl)seleninyl) phenol (SQ) inhibits cancer cell metastasis behavior of TNBC via suppressing EMT and VEGF.; Authors - Dayong Zheng
mouse,human	WB	J Oncol; EphA2 Promotes the Development of Cervical Cancer through the CXCL11/PD-L1 Pathway; Authors - Xinyue Zhao ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is highly positive, with a 5-star rating. The reviewer used it for Western Blot and Immunohistochemistry at a 1:1000 dilution and described the performance as "very good." Overall, customer feedback reflects satisfaction with the antibody's reliability across multiple applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Sai Sindhura (Verified Customer) (08-19-2026)

very good

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: 1:1000