• Featured Product
  • KD/KO Validated

EPHA7 Monoclonal antibody, PBS Only

EPHA7 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66667-1-PBS
Clone No.1A7E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

EPH homology kinase 3, EK11, EHK-3, EHK3, EHK 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66667-1-PBS targets EPHA7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3813

Product name: Recombinant human EPHA7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-279 aa of BC027940

Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

Predict reactive species
Full Name EPH receptor A7
Calculated Molecular Weight 998 aa, 112 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC027940
Gene Symbol EPHA7
Gene ID (NCBI) 2045
RRIDAB_2882021
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15375
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).

Loading...
||
New chat Able
正在加载,请稍候...