EPHA7 Monoclonal antibody, PBS Only

• 

  WB analysis of human brain using 66667-1-Ig (same clone as 66667-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66667-1-Ig (same clone as 66667-1-PBS)

  Untreated and PNGase F-treated lysates of pig brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808). This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66667-1-Ig (same clone as 66667-1-PBS)

  Untreated and PNGase F-treated lysates of rat brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808). This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66667-1-Ig (same clone as 66667-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66667-1-Ig (same clone as 66667-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 66667-1-Ig (same clone as 66667-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66667-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EPHA7 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66667-1-PBS

Clone No.1A7E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

EPH homology kinase 3, EK11, EHK-3, EHK3, EHK 3

---

Product Information

66667-1-PBS targets EPHA7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3813

  Product name: Recombinant human EPHA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-279 aa of BC027940

  Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

• Full Name: EPH receptor A7
• Calculated Molecular Weight: 998 aa, 112 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC027940
• Gene Symbol: EPHA7
• Gene ID (NCBI): 2045
• RRID: AB_2882021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15375
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).