EPHA7 Monoclonal antibody

• 

  WB analysis of human brain using 66667-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 66667-1-Ig

  Untreated and PNGase F-treated lysates of pig brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

• 

  WB analysis of rat brain using 66667-1-Ig

  Untreated and PNGase F-treated lysates of rat brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

• 

  WB analysis of pig brain using 66667-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 66667-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 66667-1-Ig

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66667-1-Ig (EPHA7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

EPHA7 Monoclonal Antibody for WB, ELISA

Cat No. 66667-1-Ig

Clone No.1A7E5

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

EPH homology kinase 3, EK11, EHK-3, EHK3, EHK 3

---

Tested Applications

• Positive WB detected in: human brain tissue, pig brain tissue, rat brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

66667-1-Ig targets EPHA7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3813

  Product name: Recombinant human EPHA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-279 aa of BC027940

  Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

• Full Name: EPH receptor A7
• Calculated Molecular Weight: 998 aa, 112 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC027940
• Gene Symbol: EPHA7
• Gene ID (NCBI): 2045
• RRID: AB_2882021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15375
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Transcriptomics-Based Liquid Biopsy for Early Detection of Recurrence in Locally Advanced Gastric Cancer; Authors - Ping'an Ding ; KD Validated
mouse	WB	Cell Rep; Activation of GPR44 decreases severity of myeloid leukemia via specific targeting of leukemia initiating stem cells; Authors - Fenghua Qian
mouse	WB	Int J Mol Sci; Fucoxanthin Prevents Pancreatic Tumorigenesis in C57BL/6J Mice That Received Allogenic and Orthotopic Transplants of Cancer Cells.; Authors - Wataru Murase