• Featured Product
  • KD/KO Validated

EPO/Erythropoietin Polyclonal antibody, PBS Only

EPO/Erythropoietin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17908-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

17908-1-PBS targets EPO/Erythropoietin in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12302

Product name: Recombinant human EPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3-193 aa of BC093628

Sequence: VHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Predict reactive species
Full Name erythropoietin
Calculated Molecular Weight 193 aa, 21 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC093628
Gene Symbol EPO/Erythropoietin
Gene ID (NCBI) 2056
RRIDAB_10638147
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01588
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin (Epo) is a 166 amino acids protein containing three N-glycosylation sites (Asn-24, Asn-38, and Asn-83) and 1 O- glycosylation site (Ser-126) and involved in the regulation of the level of red blood cells. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Loading...
||
New chat Able
正在加载,请稍候...