Product Information
17908-1-PBS targets EPO/Erythropoietin in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12302 Product name: Recombinant human EPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-193 aa of BC093628 Sequence: VHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species |
| Full Name | erythropoietin |
| Calculated Molecular Weight | 193 aa, 21 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC093628 |
| Gene Symbol | EPO/Erythropoietin |
| Gene ID (NCBI) | 2056 |
| RRID | AB_10638147 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01588 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin (Epo) is a 166 amino acids protein containing three N-glycosylation sites (Asn-24, Asn-38, and Asn-83) and 1 O- glycosylation site (Ser-126) and involved in the regulation of the level of red blood cells. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.





