ERGIC3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68398-1-Ig (same clone as 68398-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68398-1-Ig (ERGIC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68398-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68398-1-Ig (same clone as 68398-1-PBS)

  WB result of ERGIC3 antibody (68398-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERGIC3 transfected HepG2 cells. This data was developed using the same antibody clone with 68398-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ERGIC3 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68398-1-PBS

Clone No.1B9F11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ERV46, Endoplasmic reticulum-Golgi intermediate compartment protein 3, CGI-54, CGI 54, C20orf47

---

Product Information

68398-1-PBS targets ERGIC3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9190

  Product name: Recombinant human ERGIC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 44-383 aa of BC009765

  Sequence: SELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

• Full Name: ERGIC and golgi 3
• Calculated Molecular Weight: 383 aa, 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC009765
• Gene Symbol: ERGIC3
• Gene ID (NCBI): 51614
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y282
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERGIC3 (Endoplasmic reticulum-Golgi intermediate compartment protein 3 ) is located in the cis face of the Golgi apparatus and vesicular tubular structures between the transitional endoplasmic reticulum (ER) and cis-Golgi. ERGIC3 significantly affects cell growth and causes ER stress-induced cell death, and is involved in the invasion and metastasis in hepatocellular carcinomas (HCC). (PMID: 26177443, PMID: 31142615)