ERN2 Monoclonal antibody

• 

  WB analysis of JAR using 67289-1-Ig

  JAR cells were subjected to SDS PAGE followed by western blot with 67289-1-Ig (ERN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 67289-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67289-1-Ig (ERN2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67289-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67289-1-Ig (ERN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67289-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67289-1-Ig (ERN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ERN2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67289-1-Ig

Clone No.2G6A10

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

ERN2, hIRE2p, Inositol requiring protein 2, Ire1 beta, IRE1b, IRE2

---

Tested Applications

• Positive WB detected in: JAR cells, A549 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67289-1-Ig targets ERN2 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29452

  Product name: Recombinant human ERN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 452-563 aa of BC157113

  Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV

• Full Name: endoplasmic reticulum to nucleus signaling 2
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC157113
• Gene Symbol: ERN2
• Gene ID (NCBI): 10595
• RRID: AB_2882555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q76MJ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.