Tested Applications
Positive WB detected in | JAR cells, A549 cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67289-1-Ig targets ERN2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29452 Product name: Recombinant human ERN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 452-563 aa of BC157113 Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV Predict reactive species |
Full Name | endoplasmic reticulum to nucleus signaling 2 |
Observed Molecular Weight | 102 kDa |
GenBank Accession Number | BC157113 |
Gene Symbol | ERN2 |
Gene ID (NCBI) | 10595 |
RRID | AB_2882555 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q76MJ5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ERN2 antibody 67289-1-Ig | Download protocol |
IHC protocol for ERN2 antibody 67289-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |