ERO1L Polyclonal antibody, PBS Only

ERO1L Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 12007-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

EC:1.8.4.-, Endoplasmic oxidoreductin-1-like protein, Endoplasmic reticulum oxidoreductase alpha, ERO1 alpha, ERO1 L

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12007-1-PBS targets ERO1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2620

Product name: Recombinant human ERO1L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-390 aa of BC008674

Sequence: SGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMD

Predict reactive species
Full Name ERO1-like (S. cerevisiae)
Calculated Molecular Weight 468 aa, 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC008674
Gene Symbol ERO1L
Gene ID (NCBI) 30001
RRIDAB_10666441
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96HE7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ERO1L, also named as ERO1-alpha, is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. It acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It does not act as a direct oxidant of folding substrate, but relies on P4HB/PDI to transfer oxidizing equivalent. Associates with ERP44 but not with GRP54, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Glutathione may be required to regulate its activity in the endoplasmic reticulum. It may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress. It is required for the folding of immunoglobulin proteins. Responsible for the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. This antibody has no cross reaction to ERO1.

Loading...
||
New chat

Able

正在加载,请稍候...