Tested Applications
| Positive WB detected in | HepG2 cells, A431 cells, L02 cells, Rat ovary cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12007-1-AP targets ERO1L in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2620 Product name: Recombinant human ERO1L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-390 aa of BC008674 Sequence: SGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMD Predict reactive species |
| Full Name | ERO1-like (S. cerevisiae) |
| Calculated Molecular Weight | 468 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC008674 |
| Gene Symbol | ERO1L |
| Gene ID (NCBI) | 30001 |
| RRID | AB_10666441 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HE7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ERO1L, also named as ERO1-alpha, is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. It acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It does not act as a direct oxidant of folding substrate, but relies on P4HB/PDI to transfer oxidizing equivalent. Associates with ERP44 but not with GRP54, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Glutathione may be required to regulate its activity in the endoplasmic reticulum. It may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress. It is required for the folding of immunoglobulin proteins. Responsible for the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. This antibody has no cross reaction to ERO1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ERO1L antibody 12007-1-AP | Download protocol |
| WB protocol for ERO1L antibody 12007-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ERO1A antibody (Cat# 12007-1-AP) has 17 total citations published in journals including Advanced Science, Free Radical Biology and Medicine, Life Sciences, International Journal of Molecular Sciences, Cell Signaling, Journal of Virology, Transplantation, Cell Calcium, Cancers, Brain Research, and Biochemical and Biophysical Research Communications. Research fields encompass endoplasmic reticulum stress, apoptosis, cancer biology, cardiovascular disease, organ transplantation, viral infections, pulmonary hypertension, and liver disease.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Inhibition of Macrophage ARID3A Alleviates Myocardial Ischemia-Reperfusion Injury After Heart Transplantation by Reducing THBS1/CD47 Signaling-Mediated Neutrophil Extracellular Traps Formation | ||
Free Radic Biol Med Unveiling the HSP90 inhibitor mediated effects on endoplasmic reticulum stress and redox signaling:from a cancer inhibitor to retinal degeneration catalyst | ||
Ecotoxicol Environ Saf Mitochondrial dysfunction and endoplasmic reticulum stress induced by activation of PPARα leaded testicular to apoptosis in SD rats explored to di-(2-ethylhexyl) phthalate (DEHP) | ||
Life Sci Ero1a, the most strongly hypoxia-induced protein in PASMCs, promotes the development of hypoxia- and monocrotaline-induced pulmonary hypertension in rats | ||
Int J Mol Sci SIRT5 Alleviates Apoptosis of Vascular Endothelial Cells Under Simulated Microgravity via Desuccinylation of ERO1A | ||
Transplantation Protective Effect of Calpain Inhibition During Cold Ischemia on Ischemia-reperfusion Injury After Lung Transplantation |











