• Featured Product
  • KD/KO Validated

ERO1L Monoclonal antibody

ERO1L Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67416-1-Ig
Clone No.1G12E11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

1G12E11, EC:1.8.4.-, Endoplasmic oxidoreductin-1-like protein, Endoplasmic reticulum oxidoreductase alpha, ERO1 alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman pancreas cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman stomach cancer tissue
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

67416-1-Ig targets ERO1L in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29910

Product name: Recombinant human ERO1L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 20-390 aa of BC008674

Sequence: SGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMD

Predict reactive species
Full Name ERO1-like (S. cerevisiae)
Calculated Molecular Weight 468 aa, 54 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC008674
Gene Symbol ERO1L
Gene ID (NCBI) 30001
RRIDAB_2882656
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96HE7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ERO1L, also named as ERO1-alpha, is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. It acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It does not act as a direct oxidant of folding substrate, but relies on P4HB/PDI to transfer oxidizing equivalent. Associates with ERP44 but not with GRP54, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Glutathione may be required to regulate its activity in the endoplasmic reticulum. It may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress. It is required for the folding of immunoglobulin proteins. Responsible for the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. ERO1L has a calculated molecular weight of 54 kDa and can be detected as 60kDa.

Protocols

Product Specific Protocols
IF protocol for ERO1L antibody 67416-1-IgDownload protocol
IHC protocol for ERO1L antibody 67416-1-IgDownload protocol
WB protocol for ERO1L antibody 67416-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nitric Oxide

Enhancing S-nitrosoglutathione Reductase Decreases S-Nitrosylation of ERO1α and Reduces Neuronal Death in Secondary Traumatic Brain Injury

Authors - Guangjie Liu
mouseWB

Theranostics

A novel NEDD4L-TXNIP-CHOP axis in the pathogenesis of nonalcoholic steatohepatitis

Authors - Qian Guo
mouseWB

Biol Trace Elem Res

Lead (Pb) Induces Osteotoxicity Through the Activation of Mutually Reinforced ER Stress and ROS in MC3T3-E1 Cells

Authors - Siwen Xie
Loading...
||
New chat

Able

正在加载,请稍候...