Tested Applications
Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
23172-1-AP targets ERVWE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19227 Product name: Recombinant human ERVWE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 274-371 aa of BC137381 Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ Predict reactive species |
Full Name | endogenous retroviral family W, env(C7), member 1 |
Calculated Molecular Weight | 538 aa, 60 kDa |
Observed Molecular Weight | 70-73 kDa |
GenBank Accession Number | BC137381 |
Gene Symbol | ERVWE1 |
Gene ID (NCBI) | 30816 |
RRID | AB_3085707 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UQF0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ERVWE1 antibody 23172-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |