Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
23172-1-AP targets ERVWE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19227 Product name: Recombinant human ERVWE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 274-371 aa of BC137381 Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ Predict reactive species |
| Full Name | endogenous retroviral family W, env(C7), member 1 |
| Calculated Molecular Weight | 538 aa, 60 kDa |
| Observed Molecular Weight | 70-73 kDa |
| GenBank Accession Number | BC137381 |
| Gene Symbol | ERVWE1 |
| Gene ID (NCBI) | 30816 |
| RRID | AB_3085707 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UQF0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ERVWE1 antibody 23172-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

