ESCO1 Polyclonal antibody

• 

  WB analysis using 29821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29821-1-AP (ESCO1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29821-1-AP (ESCO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse small intestine using 29821-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 29821-1-AP (ESCO1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ESCO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29821-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CTF7 homolog 1, ECO1 homolog 1, EFO1, ESO1 homolog 1, hEFO1

---

Tested Applications

• Positive WB detected in: A375 cells, COLO 320 cells, SGC-7901 cells, Caco-2 cells
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29821-1-AP targets ESCO1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31189

  Product name: Recombinant human ESCO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of NM_052911

  Sequence: MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQPELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNRRSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVLEVKSDSKEDENLVINEVINSPKGKKRKVEH

• Full Name: establishment of cohesion 1 homolog 1 (S. cerevisiae)
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: NM_052911
• Gene Symbol: ESCO1
• Gene ID (NCBI): 114799
• RRID: AB_3086174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5FWF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.