ESYT2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68374-1-Ig (same clone as 68374-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68374-1-Ig (FAM62B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68374-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68374-1-Ig (same clone as 68374-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68374-1-Ig (ESYT2 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68374-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68374-1-Ig (same clone as 68374-1-PBS)

  WB result of FAM62B antibody (68374-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FAM62B transfected HeLa cells. This data was developed using the same antibody clone with 68374-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68374-1-Ig (same clone as 68374-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68374-1-Ig (FAM62B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68374-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 68374-1-Ig (same clone as 68374-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ESYT2 antibody (68374-1-Ig, Clone: 1B12G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68374-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ESYT2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68374-1-PBS

Clone No.1B12G2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FAM62B, Chr2Syt, E Syt2, E-Syt2, Extended synaptotagmin 2

---

Product Information

68374-1-PBS targets ESYT2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20440

  Product name: Recombinant human FAM62B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 559-773 aa of BC013957

  Sequence: NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRL

• Full Name: family with sequence similarity 62 (C2 domain containing) member B
• Calculated Molecular Weight: 921 aa, 102 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC013957
• Gene Symbol: ESYT2
• Gene ID (NCBI): 57488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: A0FGR8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ESYT2, also named FAM62B, is one of the three-member family of Extended Synaptotagmins that were recently shown to be implicated in the formation of endoplasmic reticulum (ER)-plasma membrane (PM) junctions and in the Ca(2+) dependent regulation of these junctions.