EXOC6 Fusion Protein

Source

e coli.-derived, PET28a

Tag

6*His

Format

Liquid

Cat no : Ag4391

Synonyms

DKFZp761I2124; EXOC6A; FLJ1125; FLJ11251; MGC33397; SEC15; SEC15L; SEC15L1; SEC15L3; Sec15p



Product Information

Peptide Sequence SESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNNIFAQFGKNDRDKQKLIETVVKQLRSLVNGMSQHM
(503-804 aa encoded by BC028395)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The protein was expressed as 6xHis-tagged fusion protein by E.Coli and purified by Ni-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 300mM imidazole.