EXOSC10 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 11178-1-AP (same clone as 11178-1-PBS)

  WB result of EXOSC10 antibody (11178-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EXOSC10 transfected HeLa cells. This data was developed using the same antibody clone with 11178-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 11178-1-AP (same clone as 11178-1-PBS)

  IP result of anti-EXOSC10 (IP:11178-1-AP, 4ug; Detection:11178-1-AP 1:300) with MCF-7 cells lysate 3200 ug. This data was developed using the same antibody clone with 11178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11178-1-AP (same clone as 11178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11178-1-AP (EXOSC10 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11178-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 11178-1-AP (same clone as 11178-1-PBS)

  Immunofluorescent analysis of NIH/3T3 cells using 11178-1-AP (EXOSC10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11178-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EXOSC10 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11178-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11178-1-PBS targets EXOSC10 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1666

  Product name: Recombinant human EXOSC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-885 aa of BC039901

  Sequence: VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

• Full Name: exosome component 10
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC039901
• Gene Symbol: EXOSC10
• Gene ID (NCBI): 5394
• RRID: AB_2293792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01780
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear
ucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.