Tested Applications
| Positive WB detected in | RAW 264.7 cells, HL-60 cells, HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20852-1-AP targets EZH1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14732 Product name: Recombinant human EZH1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 161-267 aa of BC015882 Sequence: EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPN Predict reactive species |
| Full Name | enhancer of zeste homolog 1 (Drosophila) |
| Calculated Molecular Weight | 747 aa, 85 kDa |
| Observed Molecular Weight | 80-95 kDa |
| GenBank Accession Number | BC015882 |
| Gene Symbol | EZH1 |
| Gene ID (NCBI) | 2145 |
| RRID | AB_10863659 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92800 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EZH1 antibody 20852-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EZH1 Polyclonal antibody (Cat# 20852-1-AP) has 10 citations published in journals including Molecular Cancer, Nature Communications, Molecular Cell, Developmental Cell, British Journal of Pharmacology, Oxidative Medicine and Cellular Longevity, European Journal of Medicinal Chemistry, Journal of Biological Chemistry, Photochemistry and Photobiology, and Drug Discovery and Therapeutics. Research fields span oncology (ovarian, thyroid, melanoma, breast cancer), neurodevelopmental disorders, stem cell biology, hepatic injury, and epigenetic regulation.
| Species | Application | Title |
|---|---|---|
Mol Cancer Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer | ||
Nat Commun Gain and loss of function variants in EZH1 disrupt neurogenesis and cause dominant and recessive neurodevelopmental disorders | ||
Mol Cell Thyroid cancer-associated EZH1 Q571R mutation drives chromatin compaction and H3K27me3 invasion into active chromatin. | ||
Dev Cell Polycomb Ezh1 maintains murine muscle stem cell quiescence through non-canonical regulation of Notch signaling | ||
Br J Pharmacol Fenofibrate potentiates the therapeutic efficacy of EZH2 inhibitors on melanoma via TRIM21- and OTUD4-mediated EZH2 ubiquitination. | ||
Oxid Med Cell Longev The Dietary Supplement γ-Oryzanol Attenuates Hepatic Ischemia Reperfusion Injury via Inhibiting Endoplasmic Reticulum Stress and HMGB1/NLRP3 Inflammasome. |
Reviews
What customers say
One reviewer rated this EZH1 antibody 5 stars, noting it was the fifth EZH1 antibody they tried and the only one that worked with their rat primary fibroblast cells. They achieved a clear band on Western Blot at a 1:500 dilution and expressed strong satisfaction with the result.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mengxue (Verified Customer) (11-29-2018) | This is the 5th EZH1 Ab I've tried so far and the only one that works with our rat primary cells. I got clear band on Western and I'm so happy about it!
|
