Tested Applications
Positive WB detected in | RAW 264.7 cells, HL-60 cells, HEK-293T cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 8 publications below |
IF | See 1 publications below |
Product Information
20852-1-AP targets EZH1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, chicken |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14732 Product name: Recombinant human EZH1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 161-267 aa of BC015882 Sequence: EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPN Predict reactive species |
Full Name | enhancer of zeste homolog 1 (Drosophila) |
Calculated Molecular Weight | 747 aa, 85 kDa |
Observed Molecular Weight | 80-95 kDa |
GenBank Accession Number | BC015882 |
Gene Symbol | EZH1 |
Gene ID (NCBI) | 2145 |
RRID | AB_10863659 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92800 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EZH1 antibody 20852-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cancer Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer | ||
Nat Commun Gain and loss of function variants in EZH1 disrupt neurogenesis and cause dominant and recessive neurodevelopmental disorders | ||
Oxid Med Cell Longev The Dietary Supplement γ-Oryzanol Attenuates Hepatic Ischemia Reperfusion Injury via Inhibiting Endoplasmic Reticulum Stress and HMGB1/NLRP3 Inflammasome. | ||
Eur J Med Chem Discovery of precision targeting EZH2 degraders for triple-negative breast cancer. | ||
Drug Discov Ther Ezh1 regulates expression of Cpg15/Neuritin in mouse cortical neurons.
| ||
Photochem Photobiol The m6 A reader YTHDC2 regulates UVB-induced DNA damage repair and histone modification |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mengxue (Verified Customer) (11-29-2018) | This is the 5th EZH1 Ab I've tried so far and the only one that works with our rat primary cells. I got clear band on Western and I'm so happy about it!
|