Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EZH2 Polyclonal antibody

EZH2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 21800-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1, EZH1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDU 145 cells, A431 cells, HEK-293 cells, HepG2 cells, Jurkat cells, mouse kidney tissue, NIH/3T3 cells, Raji cells, rat kidney tissue, C6 cells
Positive IP detected inHepG2 cells
Positive IHC detected inmouse testis tissue, human lung squamous cell carcinoma tissue, mouse ovary tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21800-1-AP targets EZH2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16789

Product name: Recombinant human EZH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-261 aa of BC010858

Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

Predict reactive species
Full Name enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight 751 aa, 86 kDa
Observed Molecular Weight 90-102 kDa
GenBank Accession NumberBC010858
Gene Symbol EZH2
Gene ID (NCBI) 2146
RRIDAB_10858790
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15910
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Protocols

Product Specific Protocols
FC protocol for EZH2 antibody 21800-1-APDownload protocol
IF protocol for EZH2 antibody 21800-1-APDownload protocol
IHC protocol for EZH2 antibody 21800-1-APDownload protocol
IP protocol for EZH2 antibody 21800-1-APDownload protocol
WB protocol for EZH2 antibody 21800-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Mol Cancer

Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer

Authors - Rashmi Bharti

Cancer Res

HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.

Authors - Yinghui Li
mouseChIP

Cancer Res

PRC2-mediated epigenetic suppression of type I IFN-STAT2 signaling impairs antitumor immunity in luminal breast cancer

Authors - Juyeong Hong
humanWB

Nat Commun

CDYL suppresses epileptogenesis in mice through repression of axonal Nav1.6 sodium channel expression.

Authors - Yongqing Liu
  • KD Validated
humanWB,IF

Nat Commun

Mechanically heterogeneous hydrogel with cell-programmed network restructuring promotes tissue regeneration by mechano-epigenetic modulation.

Authors - Qiangjun Ling
mouse,humanWB

Nat Commun

Phosphorylation and stabilization of EZH2 by DCAF1/VprBP trigger aberrant gene silencing in colon cancer

Authors - Nikhil B Ghate
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Nikhil (Verified Customer) (10-16-2019)

very nice

  • Applications: Western Blot,
  • Cell Tissue Type: Colon cancer cells
EZH2 Antibody Western Blot, validation ( dilution) in Colon cancer cells (Cat no:21800-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...