• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated EZH2 Polyclonal antibody

EZH2 Polyclonal Antibody for FC (Intra)
Cat No. CL647-21800

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Enhancer of zeste homolog 2, ENX 1, ENX-1, EZH1, EZH2, KMT6, Lysine N methyltransferase 6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

This antibody is not recommended for IHC.

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-21800 targets EZH2 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16789

Product name: Recombinant human EZH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-261 aa of BC010858

Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

Predict reactive species
Full Name enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight 751 aa, 86 kDa
Observed Molecular Weight 90-102 kDa
GenBank Accession NumberBC010858
Gene Symbol EZH2
Gene ID (NCBI) 2146
RRIDAB_2934948
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15910
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 EZH2 antibody CL647-21800Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...