Elafin/Skalp Polyclonal antibody, PBS Only

• 

  IHC staining of human skin cancer using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus using 15963-1-AP (same clone as 15963-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 15963-1-AP (Elafin/Skalp antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15963-1-AP (same clone as 15963-1-PBS)

  Immunofluorescent analysis of HeLa cells using 15963-1-AP (Elafin/Skalp antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15963-1-PBS in a different storage buffer formulation.

Elafin/Skalp Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 15963-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15963-1-PBS targets Elafin/Skalp in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8735

  Product name: Recombinant human PI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-117 aa of BC010952

  Sequence: AAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

• Full Name: peptidase inhibitor 3, skin-derived
• Calculated Molecular Weight: 117 aa, 12 kDa
• GenBank Accession Number: BC010952
• Gene Symbol: Elafin/Skalp
• Gene ID (NCBI): 5266
• RRID: AB_2878201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19957
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.