Tested Applications
Positive IHC detected in | human skin cancer tissue, human oesophagus tissue, human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 4 publications below |
Product Information
15963-1-AP targets Elafin/Skalp in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8735 Product name: Recombinant human PI3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-117 aa of BC010952 Sequence: AAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ Predict reactive species |
Full Name | peptidase inhibitor 3, skin-derived |
Calculated Molecular Weight | 117 aa, 12 kDa |
GenBank Accession Number | BC010952 |
Gene Symbol | Elafin/Skalp |
Gene ID (NCBI) | 5266 |
RRID | AB_2878201 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P19957 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Elafin/Skalp antibody 15963-1-AP | Download protocol |
IF protocol for Elafin/Skalp antibody 15963-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Ther Adv Med Oncol Development and external validation of a composite immune-clinical prognostic model associated with EGFR mutation in East-Asian patients with lung adenocarcinoma. | ||
Anim Biosci Spatiotemporal expression and regulation of peptidase inhibitor 3 and secretory leukocyte protease inhibitor at the maternal-fetal interface in pigs | ||
Int J Gen Med FAM3B Serves as a Biomarker for the Development and Malignancy of Oral Lichen Planus. | ||
Front Endocrinol (Lausanne) Elafin is related to immune infiltration and could predict the poor prognosis in ovarian cancer |