JAM-A/CD321 Polyclonal antibody

• 

  WB analysis using 26941-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26941-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood platelets using 26941-1-AP

  Human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 26941-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 26941-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 26941-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 26941-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 26941-1-AP (JAM-A/Junctional Adhesion Molecule A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

JAM-A/CD321 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26941-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

F11R, JAM-A/Junctional Adhesion Molecule A, CD321, F11 receptor, JAM

---

Tested Applications

• Positive WB detected in: HUVEC cells, human peripheral blood platelets, U-87 MG cells
• Positive IHC detected in: human breast cancer tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26941-1-AP targets JAM-A/CD321 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25641

  Product name: Recombinant human F11R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-162 aa of BC001533

  Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS

• Full Name: F11 receptor
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC001533
• Gene Symbol: F11R
• Gene ID (NCBI): 50848
• RRID: AB_2880692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y624
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The F11 receptor (F11R) was first identified in human platelets as a 32/35 kDa protein duplex that serves as the receptor for a functional antibody that activates platelets. It seems to play a role in epithelial tight junction formation. It was also reported to function as a receptor for reovirus and ligand for the integrin LFA1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Neuropharmacology; Δ9-tetrahydrocannabinol induces blood-brain barrier disruption: Involving the activation of CB1R and oxidative stress; Authors - Qianyao Zhang