Tested Applications
| Positive WB detected in | HUVEC cells, human peripheral blood platelets, U-87 MG cells |
| Positive IHC detected in | human breast cancer tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26941-1-AP targets JAM-A/CD321 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25641 Product name: Recombinant human F11R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-162 aa of BC001533 Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS Predict reactive species |
| Full Name | F11 receptor |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC001533 |
| Gene Symbol | F11R |
| Gene ID (NCBI) | 50848 |
| RRID | AB_2880692 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y624 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The F11 receptor (F11R) was first identified in human platelets as a 32/35 kDa protein duplex that serves as the receptor for a functional antibody that activates platelets. It seems to play a role in epithelial tight junction formation. It was also reported to function as a receptor for reovirus and ligand for the integrin LFA1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for JAM-A/CD321 antibody 26941-1-AP | Download protocol |
| WB protocol for JAM-A/CD321 antibody 26941-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













