Tested Applications
Positive WB detected in | human plasma tissue, K-562 cells, HepG2 cells, Jurkat cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27154-1-AP targets Factor XII in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25912 Product name: Recombinant human F12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 413-500 aa of BC012390 Sequence: CLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLC Predict reactive species |
Full Name | coagulation factor XII (Hageman factor) |
Calculated Molecular Weight | 615 aa, 68 kDa |
Observed Molecular Weight | 80 kDa and 52 kDa |
GenBank Accession Number | BC012390 |
Gene Symbol | Factor XII |
Gene ID (NCBI) | 2161 |
RRID | AB_2880778 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P00748 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Factor XII (F XII, Hageman factor) is a 80kD, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Factor XII antibody 27154-1-AP | Download protocol |
IHC protocol for Factor XII antibody 27154-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |