Tested Applications
Positive WB detected in | Y79 cells, K-562 cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
26366-1-AP targets PAR1/Thrombin Receptor in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, monkey, hamster |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24378 Product name: Recombinant human F2R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-102 aa of BC051909 Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Predict reactive species |
Full Name | coagulation factor II (thrombin) receptor |
Calculated Molecular Weight | 47 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC051909 |
Gene Symbol | F2R |
Gene ID (NCBI) | 2149 |
RRID | AB_2880492 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25116 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protease-activated receptor-1 (PAR1) is a G protein coupled receptor.PAR1 has a greater affinity for thrombin and mediates rapid Ca2+ mobilization and platelet activation. PAR1 has a calculated molecular weight of 47 kDa, but can be detected as 70 kDa after posttranslational modification.(PMID: 26822533)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PAR1/Thrombin Receptor antibody 26366-1-AP | Download protocol |
IHC protocol for PAR1/Thrombin Receptor antibody 26366-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Breast Cancer Res Treat Exosomal MMP-1 transfers metastasis potential in triple-negative breast cancer through PAR1-mediated EMT. | ||
Leukemia Thrombin receptor activating peptide-6 decreases acute graft-versus-host disease through activating GPR15 | ||
Genes Immun A Golgi apparatus-related signature predicts the immune microenvironment and prognosis of gastric cancer |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sammy (Verified Customer) (02-15-2024) | Several unspecific bands detected by WB one of which was the correct size. IF staining worked well but caveated by potential lack of specificity.
|