Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells, mouse liver tissue, Y79 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26366-1-AP targets PAR1/Thrombin Receptor in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, monkey, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24378 Product name: Recombinant human F2R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-102 aa of BC051909 Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT Predict reactive species |
| Full Name | coagulation factor II (thrombin) receptor |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC051909 |
| Gene Symbol | F2R |
| Gene ID (NCBI) | 2149 |
| RRID | AB_2880492 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25116 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protease-activated receptor-1 (PAR1) is a G protein coupled receptor.PAR1 has a greater affinity for thrombin and mediates rapid Ca2+ mobilization and platelet activation. PAR1 has a calculated molecular weight of 47 kDa, but can be detected as 70 kDa after posttranslational modification.(PMID: 26822533)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PAR1/Thrombin Receptor antibody 26366-1-AP | Download protocol |
| WB protocol for PAR1/Thrombin Receptor antibody 26366-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PAR1/Thrombin Receptor polyclonal antibody (catalog number 26366-1-AP) has 5 total citations. These appear in Leukemia, Scientific Reports, Biochimica et Biophysica Acta Molecular Cell Research, Genes and Immunity, and Breast Cancer Research and Treatment. The research fields span graft-versus-host disease, gastric cancer, anaplastic thyroid cancer, and triple-negative breast cancer, with applications including WB, IHC, IF, and IP.
| Species | Application | Title |
|---|---|---|
Leukemia Thrombin receptor activating peptide-6 decreases acute graft-versus-host disease through activating GPR15 | ||
Sci Rep The molecular subtype based on cell cycle-related gene signature predicts the prognosis and chemotherapy and immunotherapy response in gastric cancer.
| ||
Biochim Biophys Acta Mol Cell Res POLR1F promotes proliferation and stemness of anaplastic thyroid cancer by activating F2R/p38 MAPK signaling | ||
Genes Immun A Golgi apparatus-related signature predicts the immune microenvironment and prognosis of gastric cancer | ||
Breast Cancer Res Treat Exosomal MMP-1 transfers metastasis potential in triple-negative breast cancer through PAR1-mediated EMT. |
Reviews
What customers say
The single review rates the product 5 out of 5 stars. The user tested it on HUVEC lysate at a 1:1000 dilution for Western Blot and 1:200 for Immunofluorescence. For WB, several unspecific bands were detected, though one band appeared at the correct size. IF staining worked well, but the reviewer noted a potential lack of specificity. Overall, the product performed acceptably across both applications with some caveats regarding specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sammy (Verified Customer) (02-15-2024) | Several unspecific bands detected by WB one of which was the correct size. IF staining worked well but caveated by potential lack of specificity.
|
