FABP1 Polyclonal antibody

• 

  WB analysis using 33532-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33532-1-AP (FABP1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

FABP1 Polyclonal Antibody for WB, ELISA

Cat No. 33532-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

liver FABP, 14 kDa selenium-binding protein, Fabpl, Fatty acid-binding protein 1, Fatty acid-binding protein, liver

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse small intestine tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33532-1-AP targets FABP1 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg7278

  Product name: Recombinant Mouse FABP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-127 aa of NM_017399.4

  Sequence: NFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

• Full Name: fatty acid binding protein 1, liver
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: NM_017399.4
• Gene Symbol: Fabp1
• Gene ID (NCBI): 14080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P12710
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).