Mouse FABP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86759-3-RR (same clone as 86759-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86759-3-RR (FABP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86759-3-PBS in a different storage buffer formulation.

FABP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86759-3-PBS

Clone No.251790G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

liver FABP, 14 kDa selenium-binding protein, Fabpl, Fatty acid-binding protein 1, Fatty acid-binding protein, liver

---

Product Information

86759-3-PBS targets FABP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7278

  Product name: Recombinant Mouse FABP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-127 aa of NM_017399.4

  Sequence: NFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

• Full Name: fatty acid binding protein 1, liver
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: NM_017399.4
• Gene Symbol: Fabp1
• Gene ID (NCBI): 14080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12710
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446).