FABP5 Monoclonal antibody, PBS Only

• 

  WB analysis of A375 using 66299-1-Ig (same clone as 66299-1-PBS)

  WB result of FABP5 antibody (66299-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FABP5 transfected A375 cells. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66299-1-Ig (same clone as 66299-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66299-1-Ig (FABP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Hepa1-6 using 66299-1-Ig (same clone as 66299-1-PBS)

  WB result of FABP5 antibody (66299-1-Ig; 1:1000; room temperature for 1.5 hours) with wild-type and FABP5 knockout Hepa1-6 cells. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 66299-1-Ig (same clone as 66299-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 66299-1-Ig (FABP5 Antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66299-1-Ig (same clone as 66299-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66299-1-Ig (FABP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 66299-1-Ig (same clone as 66299-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66299-1-Ig (FABP5 Antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 66299-1-Ig (FABP5 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brown adipose using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 66299-1-Ig (FABP5 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66299-1-Ig (FABP5 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66299-1-Ig (FABP5 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66299-1-Ig (FABP5 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66299-1-Ig (FABP5 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66299-1-Ig (same clone as 66299-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using FABP5 antibody (66299-1-Ig, Clone: 1C6E12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66299-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FABP5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66299-1-PBS

Clone No.1C6E12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1C6E12, EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5

---

Product Information

66299-1-PBS targets FABP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3005

  Product name: Recombinant human FABP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC019385

  Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Full Name: fatty acid binding protein 5 (psoriasis-associated)
• Calculated Molecular Weight: 135 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC019385
• Gene Symbol: FABP5
• Gene ID (NCBI): 2171
• RRID: AB_2881682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q01469
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)