• Featured Product
  • KD/KO Validated

FABP5 Monoclonal antibody

FABP5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66299-1-Ig
Clone No.1C6E12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

1C6E12, EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, fetal human brain tissue, Hepa1-6 cells, rat brain tissue, U2OS cells, mouse brain tissue, A549 cells, HeLa cells, HEK-293 cells
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue, mouse brown adipose tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:200-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66299-1-Ig targets FABP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3005

Product name: Recombinant human FABP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-135 aa of BC019385

Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Predict reactive species
Full Name fatty acid binding protein 5 (psoriasis-associated)
Calculated Molecular Weight 135 aa, 15 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC019385
Gene Symbol FABP5
Gene ID (NCBI) 2171
RRIDAB_2881682
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01469
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)

Protocols

Product Specific Protocols
WB protocol for FABP5 antibody 66299-1-IgDownload protocol
IHC protocol for FABP5 antibody 66299-1-IgDownload protocol
IF protocol for FABP5 antibody 66299-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Oncol

Multi-Omics Analysis of Fatty Acid Metabolism in Thyroid Carcinoma.

Authors - Jinghui Lu
humanWB,IHC

Carcinogenesis

Serum fatty acid-binding protein 5 is a significant factor in hepatocellular carcinoma progression independent of tissue expression level.

Authors - Masafumi Ohira
  • KO Validated
humanIHC

Med Mol Morphol

Expression of fatty-acid-binding protein 5 in intrahepatic and extrahepatic cholangiocarcinoma: the possibility of different energy metabolisms in anatomical location.

Authors - Risa Nakagawa
mouseIF

J Allergy Clin Immunol

Melatonin treatment increases skin microbiota-derived propionic acid to alleviate atopic dermatitis

Authors - Lan Yang
humanIHC,IF

Free Radic Biol Med

Oxidative stress-induced decreased expression of FABP5 leads to mitochondrial damage and survival disorder of decidual stromal cells in women with recurrent spontaneous abortion

Authors - Dong Li
Loading...
||
New chat Able
正在加载,请稍候...