Product Information
84132-2-PBS targets FABP6 as part of a matched antibody pair:
MP01052-2: 84132-1-PBS capture and 84132-2-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag4788 Product name: Recombinant human FABP6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC022489 Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Predict reactive species | 
                                    
| Full Name | fatty acid binding protein 6, ileal | 
| Calculated Molecular Weight | 177 aa, 20 kDa | 
| GenBank Accession Number | BC022489 | 
| Gene Symbol | FABP6 | 
| Gene ID (NCBI) | 2172 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P51161 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 





