• Featured Product
  • KD/KO Validated

FADS1 Polyclonal antibody

FADS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10627-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Acyl-CoA (8-3)-desaturase, D5D, Delta-5 desaturase, EC:1.14.19.44, FADSD5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HeLa cells, Jurkat cells, mouse liver tissue
Positive IHC detected inhuman colon cancer tissue, human lung cancer tissue, human endometrial cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10627-1-AP targets FADS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, pig, chicken, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0978

Product name: Recombinant human FADS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-444 aa of BC007846

Sequence: AGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ

Predict reactive species
Full Name fatty acid desaturase 1
Calculated Molecular Weight 52 kDa, 42 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC007846
Gene Symbol FADS1
Gene ID (NCBI) 3992
RRIDAB_2231403
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60427
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FADS1, also known as Delta-5 desaturase or D5D, is a 444 amino acid protein that belongs to the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS1 is a key enzyme in polyunsaturated fatty acid (PUFA) metabolism that catalyze the conversion of linoleic acid (LA) into arachidonic acid (AA) and that of alpha-linolenic acid (ALA) into eicosapentaenoic acid (EPA). FADS1 has two isform: 42 kDa, 52 kDa. FADS1 undergoes multiple post-translational modifications, including ubiquitination, phosphorylation, and glycation, which may alter its molecular weight to 55-60 kDa.

Protocols

Product Specific Protocols
IF protocol for FADS1 antibody 10627-1-APDownload protocol
IHC protocol for FADS1 antibody 10627-1-APDownload protocol
WB protocol for FADS1 antibody 10627-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

STING orchestrates the crosstalk between polyunsaturated fatty acid metabolism and inflammatory responses.

Authors - Isabelle K Vila
humanWB

Nat Commun

The lipoprotein-associated phospholipase A2 inhibitor Darapladib sensitises cancer cells to ferroptosis by remodelling lipid metabolism

Authors - Mihee Oh
humanWB

Proc Natl Acad Sci U S A

Polyunsaturated fatty acid biosynthesis pathway determines ferroptosis sensitivity in gastric cancer.

Authors - Ji-Yoon Lee
humanIHC

Stem Cells

Increased lipogenesis is critical for self-renewal and growth of breast cancer stem cells: Impact of omega-3 fatty acids.

Authors - Haiqing Luo
mouseWB

J Lipid Res

In vivo MRS assessment of altered fatty acyl unsaturation in liver tumor formation of a TGF alpha/c-myc transgenic mouse model.

Authors - Griffitts J J
humanIHC

J Cancer

Reduced Expression of FADS1 Predicts Worse Prognosis in Non-Small-Cell Lung Cancer.

Authors - Dong Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jelan (Verified Customer) (01-14-2026)

The REDD1 antibody from Proteintech is a useful, well-validated reagent that generally produces specific bands in Western blots and works reliably when properly optimized. As with any antibody, we confirm specificity with appropriate controls and titrate conditions for your particular assay to ensure the best results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Melanoma cell lines
FH

Kristen (Verified Customer) (12-15-2025)

Used to evaluate protein expression of FADS1 in syngeneic mouse melanoma cell lines. Variable expression levels, but correct band size seen in some lines

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Murine melanoma cell lines
FH

Casey (Verified Customer) (12-02-2025)

Band was not clear. May need to add more antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Haley (Verified Customer) (12-01-2025)

Consistently reliable with repeat experiments

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cancer cell line
Loading...
||
New chat

Able

正在加载,请稍候...