Tested Applications
| Positive WB detected in | PC-3 cells, A549 cells, LNCaP cells, U2OS cells, Jurkat cells, rat liver tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
Product Information
68026-1-Ig targets FADS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species |
| Full Name | fatty acid desaturase 2 |
| Calculated Molecular Weight | 445 aa, 49 kDa |
| Observed Molecular Weight | 42-45 kDa |
| GenBank Accession Number | BC009011 |
| Gene Symbol | FADS2 |
| Gene ID (NCBI) | 9415 |
| RRID | AB_2923633 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95864 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FADS2 antibody 68026-1-Ig | Download protocol |
| IHC protocol for FADS2 antibody 68026-1-Ig | Download protocol |
| WB protocol for FADS2 antibody 68026-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cell Mol Med Identification of FADS2 as a Contributor of Ferroptosis Escape in Bladder Cancer
| ||
Proteomics Proteomics coupled transcriptomics reveals lipopolysaccharide inhibiting peroxisome proliferator-activated receptors signalling pathway to reduce lipid droplets accumulation in mouse liver | ||
Front Genet Identifification and validation of ferroptosis signatures and immune infifiltration characteristics associated with intervertebral disc degeneration | ||
Sci Rep FADS2 confers SCD1 inhibition resistance to cancer cells by modulating the ER stress response
| ||
Lipids Exogenous oxidized phytosterol may modulate linoleic acid metabolism through upregulation of fatty acid desaturase in rats | ||
FASEB J Lysosomal membrane protein TMEM106B modulates hematopoietic stem and progenitor cell proliferation and differentiation by regulating LAMP2A stability |

















