FADS2 Monoclonal antibody

• 

  WB analysis of PC-3 using 68026-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 68026-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 68026-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 68026-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 68026-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 68026-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 68026-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 68026-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 68026-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using FADS2 antibody (68026-1-Ig, Clone: 1G4B10 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

FADS2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68026-1-Ig

Clone No.1G4B10

Publications(8)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.14.19.3, Delta-6 desaturase, D6D, Acyl-CoA 6-desaturase, 1G4B10

---

Tested Applications

• Positive WB detected in: PC-3 cells, A549 cells, LNCaP cells, U2OS cells, Jurkat cells, rat liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 1 publications below

Product Information

68026-1-Ig targets FADS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27715

  Product name: Recombinant human FADS2-Specific protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC009011

  Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

• Full Name: fatty acid desaturase 2
• Calculated Molecular Weight: 445 aa, 49 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC009011
• Gene Symbol: FADS2
• Gene ID (NCBI): 9415
• RRID: AB_2923633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95864
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Proteomics; Proteomics coupled transcriptomics reveals lipopolysaccharide inhibiting peroxisome proliferator-activated receptors signalling pathway to reduce lipid droplets accumulation in mouse liver; Authors - Haiying Ran
mouse	WB	Prostaglandins Leukot Essent Fatty Acids; Fatty acid synthase global inducible knockout does not alter brain fatty acid concentrations but attenuates cholesterol synthesis in the adult mouse; Authors - Drew R Seeger
human	WB	Mol Biol Rep; FADS2 inhibits colorectal cancer cell proliferation by regulating ferroptosis through SLC7A11/GPX4; Authors - Qinghui Yang
human	WB	Sci Rep; FADS2 confers SCD1 inhibition resistance to cancer cells by modulating the ER stress response; Authors - Toshikatsu Ikeda ; KD Validated
mouse	WB	Food Res Int; Influence of fatty acid distribution on lipid metabolism and cognitive development in first-weaned mice; Authors - Xinggang Ni
human	WB	FASEB J; Lysosomal membrane protein TMEM106B modulates hematopoietic stem and progenitor cell proliferation and differentiation by regulating LAMP2A stability; Authors - Di Guo