FADS2 Monoclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 68026-1-Ig (same clone as 68026-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68026-1-Ig (same clone as 68026-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 68026-1-Ig (same clone as 68026-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 68026-1-Ig (same clone as 68026-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 68026-1-Ig (same clone as 68026-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68026-1-Ig (same clone as 68026-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 68026-1-Ig (same clone as 68026-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 68026-1-Ig (same clone as 68026-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68026-1-Ig (FADS2-Specific antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 68026-1-Ig (same clone as 68026-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using FADS2 antibody (68026-1-Ig, Clone: 1G4B10 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 68026-1-PBS in a different storage buffer formulation.

FADS2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68026-1-PBS

Clone No.1G4B10

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:1.14.19.3, Delta-6 desaturase, D6D, Acyl-CoA 6-desaturase, 1G4B10

---

Product Information

68026-1-PBS targets FADS2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27715

  Product name: Recombinant human FADS2-Specific protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC009011

  Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN

• Full Name: fatty acid desaturase 2
• Calculated Molecular Weight: 445 aa, 49 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC009011
• Gene Symbol: FADS2
• Gene ID (NCBI): 9415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95864
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing.