Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15211-1-AP targets FAIM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7366 Product name: Recombinant human FAIM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC000051 Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVR Predict reactive species |
| Full Name | Fas apoptotic inhibitory molecule 2 |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC000051 |
| Gene Symbol | FAIM2 |
| Gene ID (NCBI) | 23017 |
| RRID | AB_3085452 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BWQ8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fas apoptotic inhibitory molecule 2 (FAIM2), also known as NMP35, TMBIM2 or Protein lifeguard (LFG), is a Fas antagonist highly expressed in the nervous system. FAIM2 is an intrinsic neuroprotective factor activated by stress in photoreceptors and delays FAS-mediated photoreceptor apoptosis (PMID: 28708137). FAIM2 is a potential pan-cancer biomarker for prognosis and immune infiltration (PMID: 36185230).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FAIM2 antibody 15211-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

