FAIM2 Polyclonal antibody

• 

  WB analysis using 15211-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15211-1-AP (FAIM2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

FAIM2 Polyclonal Antibody for WB, ELISA

Cat No. 15211-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FAIM2, KIAA0950, LFG, NGP35, NMP35, Protein lifeguard, TMBIM2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15211-1-AP targets FAIM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7366

  Product name: Recombinant human FAIM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC000051

  Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVR

• Full Name: Fas apoptotic inhibitory molecule 2
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000051
• Gene Symbol: FAIM2
• Gene ID (NCBI): 23017
• RRID: AB_3085452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fas apoptotic inhibitory molecule 2 (FAIM2), also known as NMP35, TMBIM2 or Protein lifeguard (LFG), is a Fas antagonist highly expressed in the nervous system. FAIM2 is an intrinsic neuroprotective factor activated by stress in photoreceptors and delays FAS-mediated photoreceptor apoptosis (PMID: 28708137). FAIM2 is a potential pan-cancer biomarker for prognosis and immune infiltration (PMID: 36185230).