Tested Applications
| Positive WB detected in | hTERT-RPE1 cells, human testis tissue, MCF-7 cells, HCT 116 cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66258-1-Ig targets FAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2c |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17966 Product name: Recombinant human FAK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species |
| Full Name | PTK2 protein tyrosine kinase 2 |
| Calculated Molecular Weight | 1052 aa, 119 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC028733 |
| Gene Symbol | FAK |
| Gene ID (NCBI) | 5747 |
| RRID | AB_2881646 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q05397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FAK antibody 66258-1-Ig | Download protocol |
| IHC protocol for FAK antibody 66258-1-Ig | Download protocol |
| WB protocol for FAK antibody 66258-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FAK Monoclonal antibody (catalog number 66258-1-Ig) has 81 total citations. These appear across numerous journals, including Nature Communications, Cell Stem Cell, Molecular Cancer, Molecular Cell, Cell Reports, Oncogene, Cell Death & Disease, Journal of Biological Chemistry, Science Advances, ACS Nano, Cancer Letters, and Cell Signaling, among others. Research fields span oncology (breast, gastric, lung, glioblastoma, and colorectal cancers), focal adhesion and cell signaling, mechanobiology, tissue regeneration, cardiovascular disease, fibrosis, and neurology. Applications are predominantly Western blot, immunofluorescence, and immunohistochemistry.
| Species | Application | Title |
|---|---|---|
Mol Cancer c-Rel drives pancreatic cancer metastasis through fibronectin-integrin signaling-induced isolation stress resistance and EMT. | ||
Cell Stem Cell Photo-tunable hydrogels reveal cellular sensing of rapid rigidity changes through the accumulation of mechanical signaling molecules | ||
Nat Commun Mechanically heterogeneous hydrogel with cell-programmed network restructuring promotes tissue regeneration by mechano-epigenetic modulation. | ||
Nat Commun In situ osteogenic activation of mesenchymal stem cells by the blood clot biomimetic mechanical microenvironment | ||
Exp Hematol Oncol Fibronectin promotes tumor angiogenesis and progression of non-small-cell lung cancer by elevating WISP3 expression via FAK/MAPK/ HIF-1α axis and activating wnt signaling pathway | ||
ACS Nano Three-Dimensional Semiconductor Network as Regulators of Energy Metabolism Drives Angiogenesis in Bone Regeneration |
Reviews
What customers say
Both reviews are 5-star ratings for Western Blot applications. One user reported the antibody performed very well at 1:1000 dilution, producing a strong signal with short exposure time and detecting both human and mouse cell lysates with comparable intensities. The other user found it working great at 1:2000 dilution for both mouse colon tissue and colon epithelial cell lines. Overall, customers highlight strong signal, reliable cross-species detection, and consistent performance across tissue and cell line samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marco (Verified Customer) (08-10-2026) | The antibody performed very well, giving a strong signal with a short exposure time. It detected both human and mouse cell lysates loaded side by side, with comparable signal intensities.
|
Balawant (Verified Customer) (12-02-2022) | This antibody is working great both for mice colon sample as well as for colon epithelial cells
|
