Product Information
66258-1-PBS targets FAK in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2c |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17966 Product name: Recombinant human FAK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species |
| Full Name | PTK2 protein tyrosine kinase 2 |
| Calculated Molecular Weight | 1052 aa, 119 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC028733 |
| Gene Symbol | FAK |
| Gene ID (NCBI) | 5747 |
| RRID | AB_2881646 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q05397 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.

















