FAM101A Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 21113-1-AP (same clone as 21113-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21113-1-AP (FAM101A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 21113-1-AP (same clone as 21113-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21113-1-AP (FAM101A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 21113-1-AP (same clone as 21113-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21113-1-AP (FAM101A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21113-1-AP (same clone as 21113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach using 21113-1-AP (FAM101A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 21113-1-AP (same clone as 21113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach using 21113-1-AP (FAM101A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 21113-1-AP (same clone as 21113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21113-1-AP (FAM101A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 21113-1-AP (same clone as 21113-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21113-1-AP (FAM101A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21113-1-PBS in a different storage buffer formulation.

FAM101A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21113-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21113-1-PBS targets FAM101A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15314

  Product name: Recombinant human FAM101A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC141805

  Sequence: MRPRMLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQDPAPSLLGPATL

• Full Name: family with sequence similarity 101, member A
• Calculated Molecular Weight: 216 aa, 24 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC141805
• Gene Symbol: FAM101A
• Gene ID (NCBI): 144347
• RRID: AB_10733877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZTI6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.