Product Information
33932-1-PBS targets FAM102A in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40874 Product name: Recombinant human FAM102A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 156-242 aa of BC137088 Sequence: LHLSDRSFRRKKDSVESHPTWVDDTRIDADAIVEKIVQSQDFTDGSNTEDSNLRLFVSRDGSATLSGIQLATRVSSGVYEPVVIESH Predict reactive species |
| Full Name | family with sequence similarity 102, member A |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC137088 |
| Gene Symbol | FAM102A |
| Gene ID (NCBI) | 399665 |
| RRID | AB_3743116 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q5T9C2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAM102A is a mitochondria-associated protein implicated in bone remodeling, particularly through regulation of osteoclast activity. Although lacking known catalytic domains, FAM102A appears to function as a regulatory factor linking mitochondrial processes to cellular differentiation and stress responses. Genetic associations with bone mineral density highlight its relevance in skeletal biology and metabolic regulation.
