FAM107B Polyclonal antibody

• 

  WB analysis using 20527-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20527-1-AP (FAM107B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

FAM107B Polyclonal Antibody for WB, ELISA

Cat No. 20527-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C10orf45, Protein FAM107B

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20527-1-AP targets FAM107B in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14389

  Product name: Recombinant human FAM107B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-131 aa of BC004872

  Sequence: RGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES

• Full Name: family with sequence similarity 107, member B
• Calculated Molecular Weight: 131 aa, 16 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC004872
• Gene Symbol: FAM107B
• Gene ID (NCBI): 83641
• RRID: AB_3669336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H098
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.