Product Information
21504-1-AP targets FAM109A in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15970 Product name: Recombinant human FAM109A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 125-249 aa of BC034809 Sequence: QQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP Predict reactive species |
Full Name | family with sequence similarity 109, member A |
Calculated Molecular Weight | 249 aa, 27 kDa |
GenBank Accession Number | BC034809 |
Gene Symbol | FAM109A |
Gene ID (NCBI) | 144717 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N4B1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |