FAM129B Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 22553-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 22553-1-AP (FAM129B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22553-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 22553-1-AP (FAM129B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 22553-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22553-1-AP (FAM129B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 22553-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22553-1-AP (FAM129B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FAM129B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22553-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C9orf88, FAM129B, MEG 3, Niban like protein 1, OC58, Protein FAM129B

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, A431 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

22553-1-AP targets FAM129B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18314

  Product name: Recombinant human FAM129B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-341 aa of BC067366

  Sequence: DARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALM

• Full Name: family with sequence similarity 129, member B
• Calculated Molecular Weight: 733 aa, 83 kDa
• Observed Molecular Weight: 83-93 kDa
• GenBank Accession Number: BC067366
• Gene Symbol: FAM129B
• Gene ID (NCBI): 64855
• RRID: AB_2879121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96TA1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM129B, also named as Niban-like protein 1 or C9orf88, is a 746 amino acid protein, which contains one PH domain and belongs to the Niban family. FAM129B localizes in the cytoplasm and may play a role in apoptosis suppression and promote melanoma cell invasion in vitro.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int Immunopharmacol; Characterization of PANoptosis-related genes with immunoregulatory features in osteoarthritis; Authors - Zhibin Lan