FAM129B Polyclonal antibody

FAM129B Polyclonal Antibody for WB, IHC, ELISA
Cat No. 22553-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

C9orf88, FAM129B, MEG 3, Niban like protein 1, OC58, Protein FAM129B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, A431 cells
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

22553-1-AP targets FAM129B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18314

Product name: Recombinant human FAM129B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-341 aa of BC067366

Sequence: DARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALM

Predict reactive species
Full Name family with sequence similarity 129, member B
Calculated Molecular Weight 733 aa, 83 kDa
Observed Molecular Weight 83-93 kDa
GenBank Accession NumberBC067366
Gene Symbol FAM129B
Gene ID (NCBI) 64855
RRIDAB_2879121
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ96TA1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM129B, also named as Niban-like protein 1 or C9orf88, is a 746 amino acid protein, which contains one PH domain and belongs to the Niban family. FAM129B localizes in the cytoplasm and may play a role in apoptosis suppression and promote melanoma cell invasion in vitro.

Protocols

Product Specific Protocols
FC protocol for FAM129B antibody 22553-1-APDownload protocol
IHC protocol for FAM129B antibody 22553-1-APDownload protocol
WB protocol for FAM129B antibody 22553-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int Immunopharmacol

Characterization of PANoptosis-related genes with immunoregulatory features in osteoarthritis

Authors - Zhibin Lan
Loading...
||
New chat Able
正在加载,请稍候...