CoraLite® Plus 488-conjugated FAM129B Polyclonal antibody

• 

  FC experiment of HeLa using CL488-22553

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human FAM129B (CL488-22553) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

FAM129B Polyclonal Antibody for FC (Intra)

Cat No. CL488-22553

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

MINERVA, Melanoma invasion by ERK, Meg-3, MEG 3, C9orf88

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22553 targets FAM129B in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18314

  Product name: Recombinant human FAM129B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-341 aa of BC067366

  Sequence: DARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALM

• Full Name: family with sequence similarity 129, member B
• Calculated Molecular Weight: 733 aa, 83 kDa
• GenBank Accession Number: BC067366
• Gene Symbol: FAM129B
• Gene ID (NCBI): 64855
• RRID: AB_2919195
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96TA1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FAM129B, also named as Niban-like protein 1 or C9orf88, is a 746 amino acid protein, which contains one PH domain and belongs to the Niban family. FAM129B localizes in the cytoplasm and may play a role in apoptosis suppression and promote melanoma cell invasion in vitro.