CoraLite® Plus 488-conjugated FAM129B Polyclonal antibody

FAM129B Polyclonal Antibody for FC (Intra)
Cat No. CL488-22553

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

bA356B19.6, C9orf88, MEG 3, Meg-3, Melanoma invasion by ERK

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22553 targets FAM129B in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18314

Product name: Recombinant human FAM129B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-341 aa of BC067366

Sequence: DARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALM

Predict reactive species
Full Name family with sequence similarity 129, member B
Calculated Molecular Weight 733 aa, 83 kDa
GenBank Accession NumberBC067366
Gene Symbol FAM129B
Gene ID (NCBI) 64855
RRIDAB_2919195
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96TA1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FAM129B, also named as Niban-like protein 1 or C9orf88, is a 746 amino acid protein, which contains one PH domain and belongs to the Niban family. FAM129B localizes in the cytoplasm and may play a role in apoptosis suppression and promote melanoma cell invasion in vitro.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FAM129B antibody CL488-22553Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...