FAM136A Polyclonal antibody

• 

  WB analysis using 30845-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30845-1-AP (FAM136A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30845-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30845-1-AP (FAM136A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 30845-1-AP

  WB result of FAM136A antibody (30845-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FAM136A transfected MCF-7 cells.

• 

  IHC staining of mouse testis using 30845-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30845-1-AP (FAM136A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 30845-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 30845-1-AP (FAM136A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 30845-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30845-1-AP (FAM136A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 30845-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using FAM136A antibody (30845-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FAM136A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30845-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein FAM136A

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, U2OS cells, Calu-1 cells, mouse testis tissue, rat testis tissue, HeLa cells, Jurkat cells
• Positive IHC detected in: human ovary cancer tissue, mouse testis tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30845-1-AP targets FAM136A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34058

  Product name: Recombinant human FAM136A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC014975

  Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK

• Full Name: family with sequence similarity 136, member A
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC014975
• Gene Symbol: FAM136A
• Gene ID (NCBI): 84908
• RRID: AB_3086420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96C01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FEBS Open Bio; FAM136A depletion induces mitochondrial stress and reduces mitochondrial membrane potential and ATP production; Authors - Yushi Otsuka