Tested Applications
| Positive WB detected in | A431 cells, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31006-1-AP targets FAM46A in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33896 Product name: Recombinant human FAM46A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC000683 Sequence: MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI Predict reactive species |
| Full Name | family with sequence similarity 46, member A |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC000683 |
| Gene Symbol | FAM46A |
| Gene ID (NCBI) | 55603 |
| RRID | AB_3669813 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96IP4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM46A, also known as TENT5A, is a member of the FAM46 subfamily of the nucleotidyltransferase fold superfamily. It has two isoforms and has been implicated in several human diseases including retinitis pigmentosa, bone abnormalities, cancer and obesity (PMID: 32528962).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FAM46A antibody 31006-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

