Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
23149-1-AP targets FAM46B in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19523 Product name: Recombinant human FAM46B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC014160 Sequence: MPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRLDALLSEP Predict reactive species |
Full Name | family with sequence similarity 46, member B |
Calculated Molecular Weight | 424 aa, 47 kDa |
GenBank Accession Number | BC014160 |
Gene Symbol | FAM46B |
Gene ID (NCBI) | 115572 |
RRID | AB_2879218 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96A09 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
Species | Application | Title |
---|---|---|
Nucleic Acids Res FAM46B is a prokaryotic-like cytoplasmic poly(A) polymerase essential in human embryonic stem cells. | ||
Exp Mol Med FAM46B inhibits cell proliferation and cell cycle progression in prostate cancer through ubiquitination of β-catenin.
| ||
Transl Cancer Res FAM46B suppresses proliferation, migration and invasion of non-small cell lung cancer via β-catenin/MMP7 signaling |