Product Information
23149-1-AP targets FAM46B in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19523 Product name: Recombinant human FAM46B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC014160 Sequence: MPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRLDALLSEP Predict reactive species |
| Full Name | family with sequence similarity 46, member B |
| Calculated Molecular Weight | 424 aa, 47 kDa |
| GenBank Accession Number | BC014160 |
| Gene Symbol | FAM46B |
| Gene ID (NCBI) | 115572 |
| RRID | AB_2879218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96A09 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The FAM46B Polyclonal antibody (Cat# 23149-1-AP) has 5 citations. These appear in Cancer Research, Experimental & Molecular Medicine, Nucleic Acids Research, Glia, and Translational Cancer Research. The research fields span osteosarcoma stemness, prostate cancer cell cycle regulation, human embryonic stem cell biology, astroglial and stem cell functions of folliculostellate cells, and non-small cell lung cancer proliferation/migration via β-catenin/MMP7 signaling.
| Species | Application | Title |
|---|---|---|
Exp Mol Med FAM46B inhibits cell proliferation and cell cycle progression in prostate cancer through ubiquitination of β-catenin.
| ||
Nucleic Acids Res FAM46B is a prokaryotic-like cytoplasmic poly(A) polymerase essential in human embryonic stem cells. | ||
Transl Cancer Res FAM46B suppresses proliferation, migration and invasion of non-small cell lung cancer via β-catenin/MMP7 signaling |
