Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells |
Positive IHC detected in | rat colon tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
19849-1-AP targets FAM50A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13907 Product name: Recombinant human FAM50A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 76-154 aa of BC000028 Sequence: KQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKR Predict reactive species |
Full Name | family with sequence similarity 50, member A |
Calculated Molecular Weight | 325 aa, 39 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC000028 |
Gene Symbol | FAM50A |
Gene ID (NCBI) | 9130 |
RRID | AB_10641032 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14320 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FAM50A belongs to the FAM50 family. It is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for FAM50A antibody 19849-1-AP | Download protocol |
WB protocol for FAM50A antibody 19849-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |