FAM69C Polyclonal antibody

• 

  WB analysis using 32720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32720-1-AP (DIPK1C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

FAM69C Polyclonal Antibody for WB, ELISA

Cat No. 32720-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse retina tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32720-1-AP targets FAM69C in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37611

  Product name: Recombinant human DIPK1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-419 aa of NM_001044369

  Sequence: MAFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVICDKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVFWKLRQLLQATLRELQEAEK

• Full Name: chromosome 18 open reading frame 51
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46 kDa, 55 kDa, 32 kDa
• GenBank Accession Number: NM_001044369
• Gene Symbol: C18orf51
• Gene ID (NCBI): 125704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q0P6D2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM69C is a kinase critically involved in neurodegenerative dementia. Biochemical analyses uncover that FAM69C is a serine/threonine kinase. Phosphoproteomic characterizations reveal that FAM69C substrates are involved in synaptic structure and function. Reduced levels of FAM69C are found in postmortem brains of Alzheimer's disease patients. FAM69C is a protective regulator of memory and a potential therapeutic target for memory loss in neurodegenerative dementia (PMID: 35858575). FAM69C undergoes glycosylation modification, and a 55 kDa band was observed in the literature (PMID: 35858575). The mouse FAM69C has two isoforms, and the predicted molecular weight is 46 kDa and 30 kDa.